PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc03g115850.2.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family NAC
Protein Properties Length: 327aa    MW: 37545.4 Da    PI: 8.5777
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc03g115850.2.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM174.33.5e-54181441129
                 NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdke 91 
                         lppGfrFhPtdeel+++yL kkv + ++++  +i +vd++k+ePw+Lp k+k +ekewyfF+ rdkky+tg r+nrat++gyWkatgkdke
  Solyc03g115850.2.1  18 LPPGFRFHPTDEELITHYLSKKVVDMNFSA-IAIGDVDMNKIEPWELPWKAKIGEKEWYFFCVRDKKYPTGLRTNRATAAGYWKATGKDKE 107
                         79*************************999.88***************98999************************************** PP

                 NAM  92 vlskkgelvglkktLvfykgrapkgektdWvmheyrle 129
                         +++ +++lvg+kktLvfy+grap+gekt+Wv heyrle
  Solyc03g115850.2.1 108 IFR-GRSLVGMKKTLVFYRGRAPRGEKTNWVTHEYRLE 144
                         ***.999*****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.7E-6113168IPR003441NAC domain
PROSITE profilePS5100558.12618168IPR003441NAC domain
PfamPF023651.0E-2719143IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 327 aa     Download sequence    Send to blast
MENFSASVKM DDQQQMELPP GFRFHPTDEE LITHYLSKKV VDMNFSAIAI GDVDMNKIEP  60
WELPWKAKIG EKEWYFFCVR DKKYPTGLRT NRATAAGYWK ATGKDKEIFR GRSLVGMKKT  120
LVFYRGRAPR GEKTNWVTHE YRLEGRLSLN NLPKTVKNDW VICRVFQKTT GGKKIHISGL  180
VRANSDENEM VNTVLPPLTD SSPSHVHCFS NYVTTQKNQE NNMINSFNNS PNFPLLSNSI  240
DIFQRNSLPT SFTWNQNVPL QHNFPQPGSF PIQDPATLRN LLENYGHQSF KKETDMISVS  300
QETGISTDRN TEITSAQQDL DCFWTY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A9e-561117410171NO APICAL MERISTEM PROTEIN
1ut4_B9e-561117410171NO APICAL MERISTEM PROTEIN
1ut7_A9e-561117410171NO APICAL MERISTEM PROTEIN
1ut7_B9e-561117410171NO APICAL MERISTEM PROTEIN
3swm_A1e-551117413174NAC domain-containing protein 19
3swm_B1e-551117413174NAC domain-containing protein 19
3swm_C1e-551117413174NAC domain-containing protein 19
3swm_D1e-551117413174NAC domain-containing protein 19
3swp_A1e-551117413174NAC domain-containing protein 19
3swp_B1e-551117413174NAC domain-containing protein 19
3swp_C1e-551117413174NAC domain-containing protein 19
3swp_D1e-551117413174NAC domain-containing protein 19
4dul_A9e-561117410171NAC domain-containing protein 19
4dul_B9e-561117410171NAC domain-containing protein 19
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Les.89610.0cell culture| flower| leaf
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001308203.10.0NAC domain-containing protein
SwissprotQ9FLJ21e-126NC100_ARATH; NAC domain-containing protein 100
TrEMBLK4BL870.0K4BL87_SOLLC; Uncharacterized protein
STRINGSolyc03g115850.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA15224279
Representative plantOGRP1715800
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61430.11e-123NAC domain containing protein 100
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]